| Reaction Details |
|---|
 | Report a problem with these data |
| Target | CD63 antigen |
|---|
| Ligand | BDBM212280 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | High Throughput Syk Biochemical Assay |
|---|
| pH | 7±n/a |
|---|
| IC50 | 734±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Blomgren, PA; Currie, KS; Kropf, JE; Lee, SH; Lo, JR; Mitchell, SA; Schmitt, AC; Xiong, J; Xu, J; Zhao, Z; Swaminathan, S Substituted imidazo[1,2-a]pyrazines as Syk inhibitors US Patent US9290505 Publication Date 3/22/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| CD63 antigen |
|---|
| Name: | CD63 antigen |
|---|
| Synonyms: | CD63 | CD63_HUMAN | CD_antigen: CD63 | CD_antigen=CD63 | Granulophysin | LAMP-3 | Limp1 | Lysosomal-associated membrane protein 3 | Lysosome integral membrane protein 1 | MLA1 | Melanoma-associated antigen ME491 | OMA81H | Ocular melanoma-associated antigen | TSPAN30 | Tetraspanin-30 | Tspan-30 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 25640.41 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 238 |
|---|
| Sequence: | MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAV
GVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFR
QQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGIN
FNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
|
|
|
|---|
| BDBM212280 |
|---|
| n/a |
|---|
| Name | BDBM212280 |
|---|
| Synonyms: | US11517570, Example Kn.-4: | US9290505, 6-(6-aminopyridin-3-yl)-N-(3,4-dimethoxyphenyl)imidazo[1,2-a]pyrazin-8-amine | US9504684, 6-(6-aminopyridin-3-yl)-N-(3,4-dimethoxyphenyl)imidazo[1,2-a]pyrazin-8-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H18N6O2 |
|---|
| Mol. Mass. | 362.3852 |
|---|
| SMILES | COc1ccc(Nc2nc(cn3ccnc23)-c2ccc(N)nc2)cc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
