Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-Hydroxybenzoate 6-hydroxylase (3HB6H H213A)
LigandBDBM50336491
Substrate/Competitorn/a
Meas. Tech.Substrate Binding Assay
pH8±n/a
Kd 6.1e+4± 5e+3 nM
Commentsextracted
Citation Montersino SOrru RBarendregt AWestphal AHvan Duijn EMattevi Avan Berkel WJ Crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid-assisted flavoprotein strategy for regioselective aromatic hydroxylation. J Biol Chem 288:26235-45 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3-Hydroxybenzoate 6-hydroxylase (3HB6H H213A)
Name:3-Hydroxybenzoate 6-hydroxylase (3HB6H H213A)
Synonyms:n/a
Type:Dimeric flavoprotein
Mol. Mass.:43919.01
Organism:Rhodococcus jostii RHA1
Description:R. jostii 3HB6H mutant H213A
Residue:399
Sequence:
MSNLQDARIIIAGGGIGGAANALALAQKGANVTLFERASEFGEVGAGLQVGPHGARILDS
WGVLDDVLSRAFLPKNIVFRDAITAEVLTKIDLGSEFRGRYGGPYFVTHRSDLHATLVDA
ARAAGAELHTGVTVTDVITEGDKAIVSTDDGRTHEADIALGMDGLKSRLREKISGDEPVS
SGYAAYRGTTPYRDVELDEDIEDVVGYIGPRCAFIQYPLRGGEMLNQVAVFESPGFKNGI
ENWGGPEELEQAYAHCHENVRRGIDYLWKDRWWPMYDREPIENWVDGRMILLGDAAHPPL
QYLASGAVMAIEDAKCLADYAAEDFSTGGNSAWPQILKEVNTERAPRCNRILTTGRMWGE
LWHLDGTARIARNELFRTRDTSSYKYTDWLWGYSSDRAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336491
n/a
NameBDBM50336491
Synonyms:3-Hydroxy-benzoic acid | 3-Hydroxybenzoate | 3-Hydroxybenzoate, II | 3-hydroxybenzoic acid | CHEMBL65369
TypeSmall organic molecule
Emp. Form.C7H6O3
Mol. Mass.138.1207
SMILESOC(=O)c1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: