Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHis8-S530A/FLAG-Native
LigandBDBM209868
Substrate/Competitorn/a
Meas. Tech.POX Assay
pH8±n/a
Kd 2.4e+2± 5e+1 nM
Commentsextracted
Citation Dong LSharma NPJurban BJSmith WL Pre-existent asymmetry in the human cyclooxygenase-2 sequence homodimer. J Biol Chem 288:28641-55 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
His8-S530A/FLAG-Native
Name:His8-S530A/FLAG-Native
Synonyms:n/a
Type:Enzyme
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Prostaglandin endoperoxide H synthase-2 (His8-S530A)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:70089.04
Organism:Homo sapiens (Human)
Description:Human PGHS-2 S530A mutant with an octahistidine tag at the N terminus
Residue:612
Sequence:
HHHHHHHHMLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGE
NCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDS
PPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRK
FIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRL
FKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWL
REHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELL
FNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESF
TRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKE
MSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFALKGLMGNVICSPAYWK
PSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDIN
PTVLLKERSTEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Prostaglandin endoperoxide H synthase-2 (PGHS-2)(FLAG-Native)
Synonyms:Cyclooxygenase-2 (COX-2)
Type:Enzyme
Mol. Mass.:69995.82
Organism:Homo sapiens (Human)
Description:P35354; containing a FLAG tag at the N terminus
Residue:612
Sequence:
DYKDDDDKMLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGE
NCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDS
PPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRK
FIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRL
FKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWL
REHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELL
FNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESF
TRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKE
MSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWK
PSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDIN
PTVLLKERSTEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM209868
n/a
NameBDBM209868
Synonyms:3-[18-(2-carboxyethyl)-8,13-bis(ethenyl)-3,7,12,17-tetramethylporphyrin-21,24-diid-2-yl]propanoic acid;iron(2+) | Haemin | Heme
TypeSmall organic molecule
Emp. Form.C34H32N4O4
Mol. Mass.560.6434
SMILESCc1c(C=C)c2cc3[n-]c(cc4[n-]c(cc5nc(cc1n2)c(C=C)c5C)c(C)c4CCC(O)=O)c(CCC(O)=O)c3C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: