| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein kinase ITK/TSK [357-620,Y512E] |
|---|
| Ligand | BDBM213215 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | LanthaScreen Kinase Binding Assay |
|---|
| IC50 | 3.2e+2±0 nM |
|---|
| Citation |  Harling, JD; Deakin, AM; Campos, S; Grimley, R; Chaudry, L; Nye, C; Polyakova, O; Bessant, CM; Barton, N; Somers, D; Barrett, J; Graves, RH; Hanns, L; Kerr, WJ; Solari, R Discovery of novel irreversible inhibitors of interleukin (IL)-2-inducible tyrosine kinase (Itk) by targeting cysteine 442 in the ATP pocket. J Biol Chem288:28195-206 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tyrosine-protein kinase ITK/TSK [357-620,Y512E] |
|---|
| Name: | Tyrosine-protein kinase ITK/TSK [357-620,Y512E] |
|---|
| Synonyms: | EMT | ITK | ITK_HUMAN | Interlukin-2-inducible tyrosine kinase (Itk) | LYK |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 30027.99 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human Itk truncation (357-620 aa) with Y512E mutation |
|---|
| Residue: | 264 |
|---|
| Sequence: | VIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHP
KLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEA
CVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQETSSTGTKFPVKWASPEVFSFSRYS
SKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWK
ERPEDRPAFSRLLRQLAEIAESGL
|
|
|
|---|
| BDBM213215 |
|---|
| n/a |
|---|
| Name | BDBM213215 |
|---|
| Synonyms: | N-(cis-2-{[4-(4-Morpholinylmethyl)-6-([1,3]thiazolo[5,4-b]pyridin-2-ylamino)-2-pyrimidinyl]amino}cyclohexyl)-2-propenamide (4) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H30N8O2S |
|---|
| Mol. Mass. | 494.612 |
|---|
| SMILES | C=CC(=O)N[C@H]1CCCC[C@H]1Nc1nc(CN2CCOCC2)cc(Nc2nc3cccnc3s2)n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
