| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Baculoviral IAP repeat-containing protein 2 [256-363] |
|---|
| Ligand | BDBM213381 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | XIAP BIR3 & cIAP1 BIR3 Binding Assays (DELFIA) |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 1±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Reiser, U; Madden, J 6-Alkynyl Pyridine US Patent US9278978 Publication Date 3/8/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Baculoviral IAP repeat-containing protein 2 [256-363] |
|---|
| Name: | Baculoviral IAP repeat-containing protein 2 [256-363] |
|---|
| Synonyms: | API1 | BIRC2 | BIRC2_HUMAN | Cellular inhibitor of apoptosis 1 (c-IAP1/BIR3) | Cellular inhibitor of apoptosis 1 BIR3 domain (c-IAP1 BIR3) | IAP repeat-containing protein 2 (cIAP1) BIR-3 | MIHB | RNF48 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12600.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human cIAP BIR3 domain (256-363 aa) |
|---|
| Residue: | 108 |
|---|
| Sequence: | TLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRC
WESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTS
|
|
|
|---|
| BDBM213381 |
|---|
| n/a |
|---|
| Name | BDBM213381 |
|---|
| Synonyms: | US9278978, 16 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H28N8O |
|---|
| Mol. Mass. | 504.5856 |
|---|
| SMILES | CN[C@H](C)C(=O)Nc1cc(cc(n1)C#Cc1ccc2c(C)nccc2c1)-c1nc(C)nc2c(C)nn(C)c12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
