Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-catenin/APC-R3
LigandBDBM32102
Substrate/Competitorn/a
Meas. Tech.Fluorescence Polarization (FP) Assay
Temperature298.15±n/a K
Ki 171250±130 nM
Commentsextracted
Citation Ji HYu BZhang MGuo W Substituted 1H-indazol-1-ol analogs as inhibitors of beta catenin/Tcf protein-protein interactions US Patent  US9284299 Publication Date 3/15/2016
More Info.:Get all data from this article,  Assay Method
 
Beta-catenin/APC-R3
Name:Beta-catenin/APC-R3
Synonyms:n/a
Type:Enzyme
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Beta-catenin
Synonyms:n/a
Type:Protein
Mol. Mass.:60127.24
Organism:Homo sapiens (Human)
Description:aa 138-686
Residue:549
Sequence:
NLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSA
IVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAIT
TLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILA
SGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRL
VQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMM
VCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKL
LHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQ
QQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGV
LCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVE
LTSSLFRTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Adenomatous polyposis coli protein (APC-R3)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:4662.54
Organism:Homo sapiens (Human)
Description:Human APC-R3 truncation (1477-1519 aa)
Residue:43
Sequence:
QRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32102
n/a
NameBDBM32102
Synonyms:1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7(1H,6H)-dione | 1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7-dione | 1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7-quinone | MLS000087831 | SMR000024051 | US9284299, PKF118-310 | US9738628, Compound PKF118-310 | cid_66541
TypeSmall organic molecule
Emp. Form.C7H7N5O2
Mol. Mass.193.1628
SMILESCn1ncnc2c1nc(=O)n(C)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: