Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1 (CB1 I339A)
LigandBDBM21278
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
pH7.4±n/a
Kd 3.8±0.7 nM
Commentsextracted
Citation Shim JYAhn KHKendall DA Molecular basis of cannabinoid CB1 receptor coupling to the G protein heterotrimer Gaiß¿: identification of key CB1 contacts with the C-terminal helix a5 of Gai. J Biol Chem 288:32449-65 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1 (CB1 I339A)
Name:Cannabinoid receptor 1 (CB1 I339A)
Synonyms:n/a
Type:Protein
Mol. Mass.:52826.88
Organism:Homo sapiens (Human)
Description:Human CB1 I339A mutant
Residue:472
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDARLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21278
n/a
NameBDBM21278
Synonyms:5-(4-chlorophenyl)-1-(2,4-dichlorophenyl)-4-methyl-N-(piperidin-1-yl)-1H-pyrazole-3-carboxamide | Acomplia | CHEMBL111 | CHEMBL558598 | RIMONABANT HYDROCHLORIDE | Rimonabant | SR 141716A | SR141716 | SR141716A | [3H]Rimonabant | [3H]SR141716A
TypeSmall organic molecule
Emp. Form.C22H21Cl3N4O
Mol. Mass.463.787
SMILESCc1c(nn(c1-c1ccc(Cl)cc1)-c1ccc(Cl)cc1Cl)C(=O)NN1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: