Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSulfotransferase 2A1 (SULT2A1)
LigandBDBM50176062
Substrate/Competitorn/a
Meas. Tech.Amoxapine and Protriptyline Inhibition Assay
pH7.5±n/a
Temperature275.15±n/a K
Ki 7.6e+4± 1.15e+4 nM
Commentsextracted
Citation Cook IWang TFalany CNLeyh TS High accuracy in silico sulfotransferase models. J Biol Chem 288:34494-501 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sulfotransferase 2A1 (SULT2A1)
Name:Sulfotransferase 2A1 (SULT2A1)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:33776.92
Organism:Homo sapiens (Human)
Description:Q06520
Residue:285
Sequence:
MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSK
GDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLM
RNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFL
LLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVV
DKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50176062
n/a
NameBDBM50176062
Synonyms:3-(5H-dibenzo[a,d][7]annulen-5-yl)-N-methylpropan-1-amine | 3-(5H-dibenzo[a,d]cyclohepten-5-yl)-N-methyl-1-propanamine | 5-(3-methylaminopropyl)-5H-dibenzo[a,d]cycloheptene | 7-(3-methylaminopropyl)-1,2:5,6-dibenzocycloheptatriene | CHEMBL668 | N-methyl-5H-dibenzo[a,d]cycloheptene-5-propanamine | N-methyl-5H-dibenzo[a,d]cycloheptene-5-propylamine | PROTRIPTYLINE | amimetilina
TypeSmall organic molecule
Emp. Form.C19H21N
Mol. Mass.263.3767
SMILESCNCCCC1c2ccccc2C=Cc2ccccc12 |c:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: