Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetκ opioid receptor (KOR Y320F)
LigandBDBM50001714
Substrate/Competitorn/a
Meas. Tech.[3H]Diprenorphine Competition Assay
pH7.4±n/a
Temperature298.15±n/a K
Kd 1.4±0.68 nM
Commentsextracted
Citation Vardy EMosier PDFrankowski KJWu HKatritch VWestkaemper RBAubé JStevens RCRoth BL Chemotype-selective modes of action of ¿-opioid receptor agonists. J Biol Chem 288:34470-83 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
κ opioid receptor (KOR Y320F)
Name:κ opioid receptor (KOR Y320F)
Synonyms:n/a
Type:Protein
Mol. Mass.:42632.76
Organism:Homo sapiens (Human)
Description:Human KOR with Y320F mutation
Residue:380
Sequence:
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGFTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001714
n/a
NameBDBM50001714
Synonyms:2-[3-cyclopropylmethyl-11-hydroxy-15-methoxy-(1S,2R,6S,14R,15R,16R)-13-oxa-3-azahexacyclo[13.2.2.12,8.01,6.06,14.07,12]icosa-7,9,11-trien-16-yl]-2-propanol | 2-[3-cyclopropylmethyl-11-hydroxy-15-methoxy-(1S,2R,6S,14R,15R,16R)-13-oxa-3-azahexacyclo[13.2.2.12,8.01,6.06,14.07,12]icosa-7,9,11-trien-16-yl]-2-propanol(diprenorphine) | 2-[3-cyclopropylmethyl-11-hydroxy-15-methoxy-13-oxa-3-azahexacyclo[13.2.2.12,8.01,6.06,14.07,12]icosa-7(12),8,10-trien-16-yl]-2-propanol | CHEMBL281786 | DIPRENORPHINE-HCl | Diprenorphine
TypeSmall organic molecule
Emp. Form.C26H35NO4
Mol. Mass.425.5604
SMILESCO[C@]12CC[C@@]3(C[C@@H]1C(C)(C)O)[C@H]1Cc4ccc(O)c5O[C@@H]2[C@]3(CCN1CC1CC1)c45 |THB:8:7:22.21:4.3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: