Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetκ opioid receptor (KOR K227A)
LigandBDBM21130
Substrate/Competitorn/a
Meas. Tech.Homologous Competition Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 2.5±0.6 nM
Commentsextracted
Citation Vardy EMosier PDFrankowski KJWu HKatritch VWestkaemper RBAubé JStevens RCRoth BL Chemotype-selective modes of action of ¿-opioid receptor agonists. J Biol Chem 288:34470-83 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
κ opioid receptor (KOR K227A)
Name:κ opioid receptor (KOR K227A)
Synonyms:n/a
Type:Protein
Mol. Mass.:42590.66
Organism:Homo sapiens (Human)
Description:Human KOR with K227A mutation
Residue:380
Sequence:
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMAICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21130
n/a
NameBDBM21130
Synonyms:N-methyl-2-phenyl-N-[(5R,7S,8S)-7-(pyrrolidin-1-yl)-1-oxaspiro[4.5]decan-8-yl]acetamide | N-methyl-N-(7-(1-pyrrolidinyl)-1-oxaspiro(4,5)dec-8-yl)benzeneacetamide | U-69593 | U69,593 | [3H]U69593
Typeradiolabeled ligand
Emp. Form.C22H32N2O2
Mol. Mass.356.5017
SMILESCN([C@H]1CC[C@@]2(CCCO2)C[C@@H]1N1CCCC1)C(=O)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: