Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetκ opioid receptor (KOR K227A)
LigandBDBM214798
Substrate/Competitorn/a
Meas. Tech.Homologous Competition Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 2.2±1.2 nM
Commentsextracted
Citation Vardy EMosier PDFrankowski KJWu HKatritch VWestkaemper RBAubé JStevens RCRoth BL Chemotype-selective modes of action of ¿-opioid receptor agonists. J Biol Chem 288:34470-83 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
κ opioid receptor (KOR K227A)
Name:κ opioid receptor (KOR K227A)
Synonyms:n/a
Type:Protein
Mol. Mass.:42590.66
Organism:Homo sapiens (Human)
Description:Human KOR with K227A mutation
Residue:380
Sequence:
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMAICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM214798
n/a
NameBDBM214798
Synonyms:Dynorphin A (1-17) | YGGFLRRIRPKLK
TypeSmall organic molecule
Emp. Form.C75H126N24O15
Mol. Mass.1603.9547
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: