Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetM3 muscarinic receptor (M3'(3C)-Xa T552C)
LigandBDBM214800
Substrate/Competitorn/a
Meas. Tech.[3H]NMS/Carbachol Binding Assay
pH7.4±n/a
Kd 0.438±0.077 nM
Commentsextracted
Citation Hu JHu KLiu TStern MKMistry RChalliss RACostanzi SWess J Novel structural and functional insights into M3 muscarinic receptor dimer/oligomer formation. J Biol Chem 288:34777-90 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
M3 muscarinic receptor (M3'(3C)-Xa T552C)
Name:M3 muscarinic receptor (M3'(3C)-Xa T552C)
Synonyms:n/a
Type:Protein
Mol. Mass.:45888.21
Organism:Rattus norvegicus (Rat)
Description:Rat M3'(3C)-Xa with T552C mutation
Residue:405
Sequence:
MTLHSQSTTSPLFPQISSSWVHSPSEAGLPLGTVTQLGSYQISQETGQFSSQDTSSDPLG
GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLASADLIIGVIS
MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT
TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY
MPVTIMTILYWRIYKETEKRTKELAGLQASGTEIEGRIEGRIEGRTRSQITKRKRMSLIK
EKKAAQTLSAILLAFIITWTPYNIMVLVNTFADSAIPKTYWNLGYWLCYINSTVNPVAYA
LSNKTFRCTFKTLLLSQSDKRKRRKQQYQQRQSVIFHKRVPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM214800
n/a
NameBDBM214800
Synonyms:N-methylscopolamine (NMS)
TypeSmall organic molecule
Emp. Form.C18H24NO4
Mol. Mass.318.3869
SMILESC[N+]1(C)[C@H]2CC(C[C@@H]1[C@H]1O[C@@H]21)OC(=O)[C@H](CO)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: