Reaction Details |
| Report a problem with these data |
Target | Plasminogen [101-181] |
---|
Ligand | BDBM290320 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Biacore Assay |
---|
pH | 7±n/a |
---|
IC50 | 13.0±n/a nM |
---|
Comments | extracted |
---|
Citation | Haßfeld, J; Kinzel, T; Köbberling, J; Cancho-Grande, Y; Beyer, K; Röhrig, S; Köllnberger, M; Sperzel, M; Burkhardt, N; Schlemmer, K; Stegmann, C; Schuhmacher, J; Werner, M; Ellermann, M (Aza)pyridopyrazolopyrimidinones and indazolopyrimidinones and their use US Patent US10098883 Publication Date 10/16/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Plasminogen [101-181] |
---|
Name: | Plasminogen [101-181] |
Synonyms: | PLG | PLMN_HUMAN | Plasminogen (aa 101-181) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 9281.08 |
Organism: | Homo sapiens (Human) |
Description: | P00747[101-181] |
Residue: | 81 |
Sequence: | SECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQ
GPWCYTTDPEKRYDYCDILEC
|
|
|
BDBM290320 |
---|
n/a |
---|
Name | BDBM290320 |
Synonyms: | 10-Cyclopentyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride | US10098883, Example 63 | US10668071, Example 63 |
Type | Small organic molecule |
Emp. Form. | C20H24N4O |
Mol. Mass. | 336.4308 |
SMILES | O=c1cc(C2CCNCC2)n2nc3cccc(C4CCCC4)c3c2[nH]1 |
Structure |
|