Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member C2 |
---|
Ligand | BDBM220117 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Discontinuous Radiometric Assay |
---|
Ki | 1320±n/a nM |
---|
Citation | Penning, TM; Adeniji, AO; Burns, MC; Winkler, J; Twenter, B Bifunctional AKR1C3 inhibitors/androgen receptor modulators and methods of use thereof US Patent US9271961 Publication Date 3/1/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member C2 |
---|
Name: | Aldo-keto reductase family 1 member C2 |
Synonyms: | 3-alpha-HSD3 | 3-alpha-Hydroxysteroid Dehydrogenase Type 3 (AKR1C2) | AK1C2_HUMAN | AKR1C2 | Aldo-keto reductase family 1 member C2 (AK1C2) | Aldo-keto reductase family 1 member C2 (AK1C2a) | Aldo-keto reductase family 1 member C2 (AKR1C2) | Chlordecone reductase homolog HAKRD | DD-2 | DD/BABP | DDH2 | Dihydrodiol dehydrogenase 2 | Dihydrodiol dehydrogenase/bile acid-binding protein | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase | Type III 3-alpha-hydroxysteroid dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 36739.89 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 323 |
Sequence: | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY
|
|
|
BDBM220117 |
---|
n/a |
---|
Name | BDBM220117 |
Synonyms: | US9271961, 4-Carboxy-2',4'-dinitrodiphenylamine |
Type | Small organic molecule |
Emp. Form. | C13H9N3O6 |
Mol. Mass. | 303.2271 |
SMILES | OC(=O)c1cccc(Nc2ccc(cc2N(=O)=O)N(=O)=O)c1 |
Structure |
|