Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSRC
LigandBDBM50357312
Substrate/Competitorn/a
Meas. Tech.In Vitro HotSpot Kinase Assay
IC50 3.7±n/a nM
Citation Honigberg LVerner EBuggy JLoury DChen W Inhibitors of bruton's tyrosine kinase for the treatment of solid tumors US Patent  US9278100 Publication Date 3/8/2016
More Info.:Get all data from this article,  Assay Method
 
SRC
Name:SRC
Synonyms:HCK | Tyrosine-protein kinase Blk | Tyrosine-protein kinase HCK | Tyrosine-protein kinase HCK
Type:Enzyme Catalytic Domain
Mol. Mass.:59600.18
Organism:Homo sapiens (Human)
Description:gi_30795229
Residue:526
Sequence:
MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
PGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50357312
n/a
NameBDBM50357312
Synonyms:IBRUTINIB | PCI-32765 | US10124003, Ref. Ex. Compound 1 | US9108973, Ref 1 | US9181263, 1 | US9278100, 1
TypeSmall organic molecule
Emp. Form.C25H24N6O2
Mol. Mass.440.4971
SMILESNc1ncnc2n(nc(-c3ccc(Oc4ccccc4)cc3)c12)[C@@H]1CCCN(C1)C(=O)C=C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: