Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetnAChR alpha4 beta2 subtype
LigandBDBM221041
Substrate/Competitorn/a
Meas. Tech.[3H]Epibatidine Binding Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 0.067±0.01 nM
Commentsextracted
Citation Carroll FIOndachi PW Nicotinic receptor compounds US Patent  US9284322 Publication Date 3/15/2016
More Info.:Get all data from this article,  Assay Method
 
nAChR alpha4 beta2 subtype
Name:nAChR alpha4 beta2 subtype
Synonyms:n/a
Type:Enzyme
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Neuronal acetylcholine receptor subunit alpha-4 beta 2
Synonyms:Neuronal acetylcholine receptor subunit alpha 4 subtype
Type:Enzyme
Mol. Mass.:70323.63
Organism:Rattus norvegicus (Rat)
Description:P09483-2
Residue:631
Sequence:
MANSGTGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVANI
SDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELI
WRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMK
FGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFI
IRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPS
PTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLF
MKRPSVVKDNCRRLIESMHKMANAPRFWPEPVGEPGILSDICNQGLSPAPTFCNPTDTAV
ETQPTCRSPPLEVPDLKTSEVEKASPCPSPGSCPPPKSSSGAPMLIKARSLSVQHVPSSQ
EAAEDGIRCRSRSIQYCVSQDGAASLADSKPTSSPTSLKARPSQLPVSDQASPCKCTCKE
PSPVSPVTVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAM
VIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Nicotinic acetylcholine receptor alpha6/alpha3/beta2/beta3
Synonyms:N-alpha 1 | Neuronal acetylcholine receptor | Neuronal acetylcholine receptor non-alpha-1 chain | Neuronal acetylcholine receptor subunit beta-2
Type:Enzyme
Mol. Mass.:56910.32
Organism:Rattus norvegicus (Rat)
Description:P12390
Residue:500
Sequence:
MAGHSNSMALFSFSLLWLCSGVLGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLM
VSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYN
NADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRT
EIDLVLKSDVASLDDFTPSGEWDIIALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINL
IIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYL
MFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRL
RLRRRQREREGAGALFFREGPAADPCTCFVNPASVQGLAGAFRAEPTAAGPGRSVGPCSC
GLREAVDGVRFIADHMRSEDDDQSVREDWKYVAMVIDRLFLWIFVFVCVFGTVGMFLQPL
FQNYTATTFLHPDHSAPSSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM221041
n/a
NameBDBM221041
Synonyms:US9284322, Table 6, Compound 7
TypeSmall organic molecule
Emp. Form.C16H15F2N3
Mol. Mass.287.3072
SMILESFc1cc(ccn1)-c1cc(cnc1F)C1CC2CCC1N2 |THB:9:14:17.18:20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: