Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 4 (BRD4)
LigandBDBM220440
Substrate/Competitorn/a
Meas. Tech.Bromodomain Domain Binding Assay
pH6±n/a
Temperature298.15±n/a K
Ki 1.1±n/a nM
Commentsextracted
Citation Wang LPratt JKMcDaniel KFDai YFidanze SDHasvold LHolms JHKati WMLiu DMantei RAMcClellan WJSheppard GSWada CK Bromodomain inhibitors US Patent  US9296741 Publication Date 3/29/2016
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 4 (BRD4)
Name:Bromodomain-containing protein 4 (BRD4)
Synonyms:Bromodomain-containing protein 4 (BRD4-BD1)
Type:Enzyme
Mol. Mass.:13496.03
Organism:Homo sapiens (Human)
Description:BD1: amino acids K57-E168 bromodomains of human BRD4
Residue:112
Sequence:
KRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLEN
NYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM220440
n/a
NameBDBM220440
Synonyms:US9296741, 29
TypeSmall organic molecule
Emp. Form.C20H23N3O5S
Mol. Mass.417.479
SMILESCn1cc(-c2cc(NS(C)(=O)=O)ccc2OC2CCOCC2)c2cc[nH]c2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: