| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain-containing protein 4 [352-457] |
|---|
| Ligand | BDBM220482 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Bromodomain Domain Binding Assay |
|---|
| pH | 6±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | 1.2±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Wang, L; Pratt, JK; McDaniel, KF; Dai, Y; Fidanze, SD; Hasvold, L; Holms, JH; Kati, WM; Liu, D; Mantei, RA; McClellan, WJ; Sheppard, GS; Wada, CK Bromodomain inhibitors US Patent US9296741 Publication Date 3/29/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain-containing protein 4 [352-457] |
|---|
| Name: | Bromodomain-containing protein 4 [352-457] |
|---|
| Synonyms: | BRD4 | BRD4_HUMAN | Bromodomain-containing protein 4 (BRD4) | Bromodomain-containing protein 4 (BRD4)(aa 352-457) | Bromodomain-containing protein 4 (BRD4-BD2) | HUNK1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 12432.37 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | BDII: amino acid E352-M457 |
|---|
| Residue: | 106 |
|---|
| Sequence: | EQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEARE
YRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKM
|
|
|
|---|
| BDBM220482 |
|---|
| n/a |
|---|
| Name | BDBM220482 |
|---|
| Synonyms: | US9296741, 71 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H23N3O6S |
|---|
| Mol. Mass. | 481.521 |
|---|
| SMILES | CCOC(=O)c1cc2c(cn(C)c(=O)c2[nH]1)-c1cc(NS(C)(=O)=O)ccc1Oc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
