Reaction Details |
 | Report a problem with these data |
Target | Bromodomain-containing protein 4 (BRD4) |
---|
Ligand | BDBM220649 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Bromodomain Domain Binding Assay |
---|
pH | 6±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | 0.78±n/a nM |
---|
Comments | extracted |
---|
Citation | Wang L; Pratt JK; McDaniel KF; Dai Y; Fidanze SD; Hasvold L; Holms JH; Kati WM; Liu D; Mantei RA; McClellan WJ; Sheppard GS; Wada CK Bromodomain inhibitors US Patent US9296741 Publication Date 3/29/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bromodomain-containing protein 4 (BRD4) |
---|
Name: | Bromodomain-containing protein 4 (BRD4) |
Synonyms: | Bromodomain-containing protein 4 (BRD4-BD2) |
Type: | Enzyme |
Mol. Mass.: | 12432.37 |
Organism: | Homo sapiens (Human) |
Description: | BD2: amino acids E352-M457 bromodomains of human BRD4 |
Residue: | 106 |
Sequence: | EQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEARE
YRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKM
|
|
|
BDBM220649 |
---|
n/a |
---|
Name | BDBM220649 |
Synonyms: | US9296741, 238 |
Type | Small organic molecule |
Emp. Form. | C18H20N4O3S |
Mol. Mass. | 372.441 |
SMILES | Cn1cc(-c2cc(ccc2NCC2CC2)S(N)(=O)=O)c2cc[nH]c2c1=O |
Structure |
|