Reaction Details |
| Report a problem with these data |
Target | Nuclear receptor ROR-gamma [258-518,Y502F] |
---|
Ligand | BDBM221242 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | RORγt Reporter Assay |
---|
IC50 | 360±n/a nM |
---|
Citation | Leonard, KA; Barbay, K; Edwards, JP; Kreutter, KD; Kummer, DA; Maharoof, U; Nishimura, R; Urbanski, M; Venkatesan, H; Wang, A; Wolin, RL; Woods, CR; Fourie, A; Xue, X Heteroaryl linked quinolinyl modulators of RORγt US Patent US9303015 Publication Date 4/5/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nuclear receptor ROR-gamma [258-518,Y502F] |
---|
Name: | Nuclear receptor ROR-gamma [258-518,Y502F] |
Synonyms: | NR1F3 | RORC | RORG | RORG_HUMAN | RZRG | Retinoic acid-related nuclear receptor gamma t (RORgammat) |
Type: | Enzyme |
Mol. Mass.: | 30130.98 |
Organism: | Homo sapiens (Human) |
Description: | Artificial LBD sequence mutated AF2 domain (Seq No: 9) |
Residue: | 261 |
Sequence: | STPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMW
ERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVF
FEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKR
KVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAA
FPPLFKELFSTETESPVGLSK
|
|
|
BDBM221242 |
---|
n/a |
---|
Name | BDBM221242 |
Synonyms: | US9303015, 16 |
Type | Small organic molecule |
Emp. Form. | C28H24Cl2N4O2 |
Mol. Mass. | 519.422 |
SMILES | CN(C)c1nc2ccc(cc2c(Cl)c1Oc1ccccc1)C(O)(c1cncn1C)c1ccc(Cl)cc1 |
Structure |
|