| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nuclear receptor ROR-gamma [258-518,Y502F] |
|---|
| Ligand | BDBM221253 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | RORγt Reporter Assay |
|---|
| IC50 | 95±n/a nM |
|---|
| Citation |  Leonard, KA; Barbay, K; Edwards, JP; Kreutter, KD; Kummer, DA; Maharoof, U; Nishimura, R; Urbanski, M; Venkatesan, H; Wang, A; Wolin, RL; Woods, CR; Fourie, A; Xue, X Heteroaryl linked quinolinyl modulators of RORγt US Patent US9303015 Publication Date 4/5/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nuclear receptor ROR-gamma [258-518,Y502F] |
|---|
| Name: | Nuclear receptor ROR-gamma [258-518,Y502F] |
|---|
| Synonyms: | NR1F3 | RORC | RORG | RORG_HUMAN | RZRG | Retinoic acid-related nuclear receptor gamma t (RORgammat) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 30130.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Artificial LBD sequence mutated AF2 domain (Seq No: 9) |
|---|
| Residue: | 261 |
|---|
| Sequence: | STPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMW
ERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVF
FEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKR
KVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAA
FPPLFKELFSTETESPVGLSK
|
|
|
|---|
| BDBM221253 |
|---|
| n/a |
|---|
| Name | BDBM221253 |
|---|
| Synonyms: | US9303015, 27a | US9303015, 27b | US9303015, 27c |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H26ClF6N5O2 |
|---|
| Mol. Mass. | 650.014 |
|---|
| SMILES | CCN(CC)c1nc2ccc(cc2c(c1Oc1ccc(Cl)cc1)C(F)(F)F)C(O)(c1cncn1C)c1ccc(nc1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
