Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor protein alpha-3/beta-2 subunit
LigandBDBM50382474
Substrate/Competitorn/a
Meas. Tech.[3H]-Epibatidine Radioligand Binding Assay
pH7.4±n/a
Temperature277.15±n/a K
Ki 0.38±n/a nM
Commentsextracted
Citation Xiao YKellar KJBrown MLPaige MALiu YLevin EDRezvani AH 2,5-disubstituted-pyridyl nicotinic ligands, and methods of use thereof US Patent  US9303017 Publication Date 4/5/2016
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor protein alpha-3/beta-2 subunit
Name:Neuronal acetylcholine receptor protein alpha-3/beta-2 subunit
Synonyms:Neuronal acetylcholine receptor; alpha3/beta2 | nAChR subtypes alpha3 beta2
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 143243
Components:This complex has 2 components.
Component 1
Name:Nicotinic acetylcholine receptor alpha6/alpha3/beta2/beta3
Synonyms:N-alpha 1 | Neuronal acetylcholine receptor | Neuronal acetylcholine receptor non-alpha-1 chain | Neuronal acetylcholine receptor subunit beta-2
Type:Enzyme
Mol. Mass.:56910.32
Organism:Rattus norvegicus (Rat)
Description:P12390
Residue:500
Sequence:
MAGHSNSMALFSFSLLWLCSGVLGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLM
VSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYN
NADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRT
EIDLVLKSDVASLDDFTPSGEWDIIALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINL
IIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYL
MFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRL
RLRRRQREREGAGALFFREGPAADPCTCFVNPASVQGLAGAFRAEPTAAGPGRSVGPCSC
GLREAVDGVRFIADHMRSEDDDQSVREDWKYVAMVIDRLFLWIFVFVCVFGTVGMFLQPL
FQNYTATTFLHPDHSAPSSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:NIcotinic acetylcholine receptor alpha-3/beta-4/alpha-5
Synonyms:Cholinergic, Nicotinic Alpha3Beta2 | Neuronal acetylcholine receptor protein alpha-3 subunit | Nicotinic acetylcholine receptor alpha6/alpha3/beta4
Type:Enzyme
Mol. Mass.:56995.52
Organism:Rattus norvegicus (Rat)
Description:P04757
Residue:499
Sequence:
MGVVLLPPPLSMLMLVLMLLPAASASEAEHRLFQYLFEDYNEIIRPVANVSHPVIIQFEV
SMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNN
ADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAK
IDLVLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTI
NLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGE
YLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSGEGDT
PKTRTFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSE
SVNAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILV
CILGTAGLFLQPLMARDDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50382474
n/a
NameBDBM50382474
Synonyms:CHEMBL2024096 | US9303017, Sazetidine-A
TypeSmall organic molecule
Emp. Form.C15H20N2O2
Mol. Mass.260.3315
SMILESOCCCCC#Cc1cncc(OC[C@@H]2CCN2)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: