Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetα-glucosidase
LigandBDBM222222
Substrate/Competitorn/a
Meas. Tech.α-Glucosidase Inhibition Assay
IC50 2.95e+3± 1 nM
Citation Chaudhry FNaureen SHuma RShaukat AAl-Rashida MAsif NAshraf MMunawar MAKhan MA In search of new a-glucosidase inhibitors: Imidazolylpyrazole derivatives. Bioorg Chem 71:102-109 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
α-glucosidase
Name:α-glucosidase
Synonyms:Alpha-glucosidase | Alpha-glucosidase (α-glucosidase) | Oligo-1,6-glucosidase
Type:Protein
Mol. Mass.:68577.59
Organism:Saccharomyces cerevisiae S288c (Baker's yeast)
Description:n/a
Residue:589
Sequence:
MTISSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWIS
PFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWF
KESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCS
TQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQS
SDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSEL
FNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRF
GDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIK
EEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGIN
VEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAA
LNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM222222
n/a
NameBDBM222222
Synonyms:6-Bromo-3-(4-(4,5-diphenyl-1H-imidazol-2-yl)-1-phenyl-1Hpyrazol-3-yl)-2H-chromen 2-one (2k)
TypeSmall organic molecule
Emp. Form.C33H21BrN4O2
Mol. Mass.585.449
SMILESBrc1ccc2oc(=O)c(cc2c1)-c1nn(cc1-c1nc(c([nH]1)-c1ccccc1)-c1ccccc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: