Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 144 (CYP144A1-TRV)
LigandBDBM24656
Substrate/Competitorn/a
Meas. Tech.Optical Titration Assay
pH7±n/a
Kd 2.980e+6± 3.00e+5 nM
Commentsextracted
Citation Kavanagh MEChenge JZoufir AMcLean KJCoyne AGBender AMunro AWAbell C Fragment Profiling Approach to Inhibitors of the Orphan M. tuberculosis P450 CYP144A1. Biochemistry 56:1559-1572 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 144 (CYP144A1-TRV)
Name:Cytochrome P450 144 (CYP144A1-TRV)
Synonyms:n/a
Type:Protein
Mol. Mass.:43963.64
Organism:Mycobacterium tuberculosis
Description:M. tuberculosis cytochrome P450 144 truncation (31-434 aa)
Residue:404
Sequence:
MTIAKDANTFFGAESVQDPYPLYERMRAAGSVHRIANSDFYAVCGWDAVNEAIGRPEDFS
SNLTATMTYTAEGTAKPFEMDPLGGPTHVLATADDPAHAVHRKLVLRHLAAKRIRVMEQF
TVQAADRLWVDGMQDGCIEWMGAMANRLPMMVVAELIGLPDPDIAQLVKWGYAATQLLEG
LVENDQLVAAGVALMELSGYIFEQFDRAAADPRDNLLGELATACASGELDTLTAQVMMVT
LFAAGGESTAALLGSAVWILATRPDIQQQVRANPELLGAFIEETLRYEPPFRGHYRHVRN
ATTLDGTELPADSHLLLLWGAANRDPAQFEAPGEFRLDRAGGKGHISFGKGAHFCVGAAL
ARLEARIVLRLLLDRTSVIEAADVGGWLPSILVRRIERLELAVQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM24656
n/a
NameBDBM24656
Synonyms:4-PIM | 4-Phenylimidazole | 4-phenyl-1H-imidazole | 4-phenylimidazole, 4-PI | CHEMBL14145 | US9138393, 4-Phenyl- imidazole | US9144538, 4-Phenylimidazole
TypeSmall organic molecule
Emp. Form.C9H8N2
Mol. Mass.144.1732
SMILESc1nc(c[nH]1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: