Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein arginine methyltransferase 8 (PRMT8)
LigandBDBM223137
Substrate/Competitorn/a
Meas. Tech.In Vitro Enzymatic Assay
Temperature298.15±n/a K
IC50>1.00e+5± 0 nM
Commentsextracted
Citation Ji SMa SWang WJHuang SZWang TQXiang RHu YGChen QLi LLYang SY Discovery of selective protein arginine methyltransferase 5 inhibitors and biological evaluations. Chem Biol Drug Des 89:585-598 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein arginine methyltransferase 8 (PRMT8)
Name:Protein arginine N-methyltransferase 8
Synonyms:HRMT1L3 | HRMT1L4 | Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4 | PRMT8 | Protein arginine N-methyltransferase 8 | Protein arginine N-methyltransferase 8 (PRMT8)
Type:Protein
Mol. Mass.:45293.70
Organism:Homo sapiens (Human)
Description:n/a
Residue:394
Sequence:
MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGK
MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGS
GTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVD
IIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWE
NVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQR
NDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISM
KPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223137
n/a
NameBDBM223137
Synonyms:P5i-6
TypeSmall organic molecule
Emp. Form.C12H10ClN3O2
Mol. Mass.263.68
SMILESNC(=O)N\N=C\c1ccc(o1)-c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: