Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEnoyl-ACP reductase (FabI1)
LigandBDBM50373349
Substrate/Competitorn/a
Meas. Tech.Inhibition Kinetics Assay
pH8±0
Temperature298.15±0 K
Ki 158±0 nM
Citation Neckles CEltschkner SCummings JEHirschbeck MDaryaee FBommineni GRZhang ZSpagnuolo LYu WDavoodi SSlayden RAKisker CTonge PJ Rationalizing the Binding Kinetics for the Inhibition of the Burkholderia pseudomallei FabI1 Enoyl-ACP Reductase. Biochemistry 56:1865-1878 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Enoyl-ACP reductase (FabI1)
Name:Enoyl-ACP reductase (FabI1)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:27824.56
Organism:Burkholderia pseudomallei
Description:Q3JG55
Residue:253
Sequence:
MRLQHKRGLIIGIANENSIAFGCARVMREQGAELALTYLNEKAEPYVRPLAQRLDSRLVV
PCDVREPGRLEDVFARIAQEWGQLDFVLHSIAYAPKEDLHRRVTDCSQAGFAMAMDVSCH
SFIRVARLAEPLMTNGGCLLTVTFYGAERAVEDYNLMGPVKAALEGSVRYLAAELGPRRI
RVHALSPGPLKTRAASGIDRFDALLERVRERTPGHRLVDIDDVGHVAAFLASDDAAALTG
NVEYIDGGYHVVG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50373349
n/a
NameBDBM50373349
Synonyms:CHEMBL264417 | PT12
TypeSmall organic molecule
Emp. Form.C18H21NO4
Mol. Mass.315.3636
SMILESCCCCCCc1ccc(Oc2ccc(cc2)[N+]([O-])=O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: