| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene C4 synthase |
|---|
| Ligand | BDBM223286 |
|---|
| Substrate/Competitor | LTC4 |
|---|
| Meas. Tech. | In Vitro hLTC4 Synthase Enzyme Assay (Test A) |
|---|
| pH | 7.8±n/a |
|---|
| IC50 | 39±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C Compounds and uses US Patent US20160326143 Publication Date 11/10/2016 |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Leukotriene C4 synthase |
|---|
| Name: | Leukotriene C4 synthase |
|---|
| Synonyms: | LTC4 synthase | LTC4S | LTC4S_HUMAN | Leukotriene-C(4) synthase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 16575.59 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_961179 |
|---|
| Residue: | 150 |
|---|
| Sequence: | MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA
LAALGLLAHFLPAALRAALLGRLRTLLPWA
|
|
|
|---|
| BDBM223286 |
|---|
| LTC4 |
|---|
| Name | BDBM223286 |
|---|
| Synonyms: | (2-(1H-Tetrazol-5-yl)cyclopropyl)(5-((cyclopropylmethyl)(4-fluoronaphthalen-1-yl)amino)-3-methoxypyridin-2-yl)methanone | US20160326143, 61 | US9657001, 61 |
|---|
| Type | Small Organic Molecule |
|---|
| Emp. Form. | C25H23FN6O2 |
|---|
| Mol. Mass. | 458.4875 |
|---|
| SMILES | COc1cc(cnc1C(=O)C1CC1c1nnn[nH]1)N(CC1CC1)c1ccc(F)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
