| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RAC-alpha serine/threonine-protein kinase [1-123] |
|---|
| Ligand | BDBM50304369 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | SPR Competitive Binding Assay |
|---|
| Ki | 2400±600 nM |
|---|
| Citation |  Mahadevan, D; Meuillet, EJ; Mash, Jr., EA; Gokhale, VM; Powis, G; Zhang, S Small molecule inhibitors of the pleckstrin homology domain and methods for using same US Patent US9320734 Publication Date 4/26/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RAC-alpha serine/threonine-protein kinase [1-123] |
|---|
| Name: | RAC-alpha serine/threonine-protein kinase [1-123] |
|---|
| Synonyms: | AKT1 | AKT1_HUMAN | PKB | RAC | RAC-alpha serine/threonine-protein kinase (Akt) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 14664.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | PLECKSTRIN HOMOLOGY DOMAIN RESIDUES 1-123 (PH Domain) |
|---|
| Residue: | 123 |
|---|
| Sequence: | MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSG
|
|
|
|---|
| BDBM50304369 |
|---|
| n/a |
|---|
| Name | BDBM50304369 |
|---|
| Synonyms: | 4-dodecyl-N-(1,3,4-thiadiazol-2-yl)benzenesulfonamide | CHEMBL595583 | US9320734, 104 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H31N3O2S2 |
|---|
| Mol. Mass. | 409.609 |
|---|
| SMILES | CCCCCCCCCCCCc1ccc(cc1)S(=O)(=O)Nc1nncs1 |
|---|
| Structure | 
|
|---|
Search and Browse
