Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein lysine methyltransferase SUV4-20H1 (SUV4-20H1)
LigandBDBM223982
Substrate/Competitorn/a
Meas. Tech.Scintillation Proximity Assay (SPA)
pH8±0
Temperature298.15±0 K
IC50>1.0e+4± 0 nM
Citation Bromberg KDMitchell TRUpadhyay AKJakob CGJhala MAComess KMLasko LMLi CTuzon CTDai YLi FEram MSNuber ASoni NBManaves VAlgire MASweis RFTorrent MSchotta GSun CMichaelides MRShoemaker ARArrowsmith CHBrown PJSanthakumar VMartin ARice JCChiang GGVedadi MBarsyte-Lovejoy DPappano WN The SUV4-20 inhibitor A-196 verifies a role for epigenetics in genomic integrity. Nat Chem Biol 13:317-324 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein lysine methyltransferase SUV4-20H1 (SUV4-20H1)
Name:Protein lysine methyltransferase SUV4-20H1 (SUV4-20H1)
Synonyms:Histone-lysine N-methyltransferase SUV420H1 | KMT5B | Lysine N-methyltransferase 5B | SUV420H1 | Su(var)4-20 homolog 1 | Suppressor of variegation 4-20 homolog 1 | Suv4-20h1
Type:Enzyme
Mol. Mass.:99218.58
Organism:Homo sapiens (Human)
Description:Q4FZB7
Residue:885
Sequence:
MKWLGESKIMVVNGRRNGGKLSNDHQQNQSKLQHTGKDTLKAGKNAVERRSNRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFS
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSKSRTLTRQSMSRIPA
SSNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKNASRKLEMGNLVLKEP
KVVLYKNLPIKKDKEPEGPAQAAVASGCLTRHAAREHRQNPVRGAHSQGESSPCTYITRR
SVRTRTNLKEASDIKLEPNTLNGYKSSVTEPCPDSGEQLQPAPVLQEEELAHETAQKGEA
KCHKSDTGMSKKKSRQGKLVKQFAKIEESTPVHDSPGKDDAVPDLMGPHSDQGEHSGTVG
VPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTL
RRRHDSSSKTNDQENDGMNSSKISIKLSKDHDNDNNLYVAKLNNGFNSGSGSSSTKLKIQ
LKRDEENRGSYTEGLHENGVCCSDPLSLLESRMEVDDYSQYEEESTDDSSSSEGDEEEDD
YDDDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223982
n/a
NameBDBM223982
Synonyms:(6,7-Dichloro-4-(cyclopentylamino)phthalazin-1-yl)(4-hydroxypiperidin-1-yl)methanone | A-197 (4)
TypeSmall organic molecule
Emp. Form.C19H22Cl2N4O2
Mol. Mass.409.31
SMILESOC1CCN(CC1)C(=O)c1nnc(NC2CCCC2)c2cc(Cl)c(Cl)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: