Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein lysine methyltransferase SUV4-20H2 (SUV4-20H2)
LigandBDBM223981
Substrate/Competitorn/a
Meas. Tech.Scintillation Proximity Assay (SPA)
pH8±0
Temperature298.15±0 K
IC50 144± 0 nM
Citation Bromberg KDMitchell TRUpadhyay AKJakob CGJhala MAComess KMLasko LMLi CTuzon CTDai YLi FEram MSNuber ASoni NBManaves VAlgire MASweis RFTorrent MSchotta GSun CMichaelides MRShoemaker ARArrowsmith CHBrown PJSanthakumar VMartin ARice JCChiang GGVedadi MBarsyte-Lovejoy DPappano WN The SUV4-20 inhibitor A-196 verifies a role for epigenetics in genomic integrity. Nat Chem Biol 13:317-324 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein lysine methyltransferase SUV4-20H2 (SUV4-20H2)
Name:Protein lysine methyltransferase SUV4-20H2 (SUV4-20H2)
Synonyms:Histone-lysine N-methyltransferase SUV420H2 | KMT5C | Lysine N-methyltransferase 5C | SUV420H2 | Su(var)4-20 homolog 2 | Suppressor of variegation 4-20 homolog 2 | Suv4-20h2
Type:Enzyme
Mol. Mass.:52147.69
Organism:Homo sapiens (Human)
Description:Q86Y97
Residue:462
Sequence:
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRD
LEAAYRALTLGGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECHTCERKGEG
AFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSGSRQGLLGPRACVHPSPLRRDPFCAA
CQPLRLPACSARPDTSPLWLQWLPQPQPRVRPRKRRRPRPRRAPVLSTHHAARVSLHRWG
GCGPHCRLRGEALVALGQPPHARWAPQQDWHWARRYGLPYVVRVDLRRLAPAPPATPAPA
GTPGPILIPKQALAFAPFSPPKRLRLVVSHGSIDLDVGGEEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223981
n/a
NameBDBM223981
Synonyms:6,7-Dichloro-N-cyclopentyl-4-(pyridin-4-yl)phthalazin-1-amine | A-196 (3)
TypeSmall organic molecule
Emp. Form.C18H16Cl2N4
Mol. Mass.359.252
SMILESClc1cc2c(NC3CCCC3)nnc(-c3ccncc3)c2cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: