Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPolycomb repressive complex 2 (PRC2)
LigandBDBM225230
Substrate/CompetitorH3K27me0
Meas. Tech.PRC2 Biochemical Assay
pH8±n/a
IC50 23.4±0.0 nM
Commentsextracted
Citation Qi WZhao KGu JHuang YWang YZhang HZhang MZhang JYu ZLi LTeng LChuai SZhang CZhao MChan HChen ZFang DFei QFeng LFeng LGao YGe HGe XLi GLingel ALin YLiu YLuo FShi MWang LWang ZYu YZeng JZeng CZhang LZhang QZhou SOyang CAtadja PLi E An allosteric PRC2 inhibitor targeting the H3K27me3 binding pocket of EED. Nat Chem Biol 13:381-388 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Polycomb repressive complex 2 (PRC2)
Name:Polycomb repressive complex 2 (PRC2)
Synonyms:EZH2/PRC2
Type:Protein
Mol. Mass.:n/a
Description:Human five-member PRC2 complex (EZH2/EED/SUZ12/AEBP2/RBAP48)
Components:This complex has 5 components.
Component 1
Name:Enhancer of zeste homolog 2 (EZH2)
Synonyms:n/a
Type:Protein
Mol. Mass.:86024.60
Organism:Homo sapiens (Human)
Description:Q15910-2
Residue:751
Sequence:
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEW
KQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHRKC
NYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRR
GRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQ
TPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESS
IIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCP
CVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWD
SKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRG
KVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRA
IQTGEELFFDYRYSQADALKYVGIEREMEIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:EZH2/SUZ12/EED/RBBP7/RBBP4
Synonyms:EED | Polycomb protein EED | WAIT-1 | WD protein associating with integrin cytoplasmic tails 1 | hEED
Type:Protein
Mol. Mass.:50201.68
Organism:Homo sapiens (Human)
Description:O75530
Residue:441
Sequence:
MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTP
NAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNR
VTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITM
QCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVL
SADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFS
TRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQ
CDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR
DSSILIAVCDDASIWRWDRLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:Polycomb protein SUZ12 (SUZ12)
Synonyms:CHET9 | ChET 9 protein | Chromatin precipitated E2F target 9 protein | JJAZ1 | Joined to JAZF1 protein | KIAA0160 | Polycomb protein SUZ12 | SUZ12 | Suppressor of zeste 12 protein homolog
Type:Protein
Mol. Mass.:83080.09
Organism:Homo sapiens (Human)
Description:Q15022
Residue:739
Sequence:
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSA
AAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSH
RNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPS
NSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMT
VFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPN
ENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVY
HPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASM
SEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQI
EEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHL
VSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEK
ALETDSVSGVSKQSKKQKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 4
Name:Adipocyte enhancer-binding protein 2 (AEBP2)
Synonyms:Zinc finger protein AEBP2
Type:Protein
Mol. Mass.:54448.84
Organism:Homo sapiens (Human)
Description:Q6ZN18
Residue:517
Sequence:
MAAAITDMADLEELSRLSPLPPGSPGSAARGRAEPPEEEEEEEEEEEEAEAEAVAALLLN
GGSGGGGGGGGGGVGGGEAETMSEPSPESASQAGEDEDEEEDDEEEEDESSSSGGGEEES
SAESLVGSSGGSSSDETRSLSPGAASSSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSV
VSSGGDEGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSISSTIMDVDSTISSGR
STPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWK
GCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSK
VSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIE
SLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKL
PKDTALLLDPNIYRTMPQKRLKRTLIRKVFNLYLSKQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 5
Name:Retinoblastoma-binding protein p48 (RBAP48)
Synonyms:n/a
Type:Protein
Mol. Mass.:47627.91
Organism:Homo sapiens (Human)
Description:Q09028
Residue:425
Sequence:
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKD
FSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
INHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEG
YGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE
SLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL
WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAE
DGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP
EGQGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM225230
H3K27me0
Name:H3K27me0
Synonyms:n/a
Type:Protein
Mol. Mass.:2585.54
Organism:Homo sapiens (Human)
Description:Human H3 peptide (21-44 aa)
Residue:24
Sequence:
LATKAARKSAPSTGGVKKPHRYRP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: