Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPRMT5/MEP50 Enzyme
LigandBDBM225230
Substrate/Competitorn/a
Meas. Tech.HMT Assay
IC50>1.00e+5± 0 nM
Citation Qi WZhao KGu JHuang YWang YZhang HZhang MZhang JYu ZLi LTeng LChuai SZhang CZhao MChan HChen ZFang DFei QFeng LFeng LGao YGe HGe XLi GLingel ALin YLiu YLuo FShi MWang LWang ZYu YZeng JZeng CZhang LZhang QZhou SOyang CAtadja PLi E An allosteric PRC2 inhibitor targeting the H3K27me3 binding pocket of EED. Nat Chem Biol 13:381-388 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
PRMT5/MEP50 Enzyme
Name:PRMT5/MEP50 Enzyme
Synonyms:PRMT5/MEP50 | PRMT5/MEP50 complex
Type:Protein
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:PRMT5/MEP50 complex
Synonyms:72 kDa ICln-binding protein | HRMT1L5 | Histone-arginine N-methyltransferase PRMT5 | IBP72 | JBP1 | Jak-binding protein 1 | PRMT5 | PRMT5/MEP50 complex | Protein arginine N-methyltransferase 5 (PRMT5) | Protein arginine methyltransferase 5 (PRMT5) | SKB1 | SKB1 homolog | SKB1Hs | Shk1 kinase-binding protein 1 homolog
Type:Enzyme
Mol. Mass.:72679.99
Organism:Homo sapiens (Human)
Description:O14744
Residue:637
Sequence:
MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAK
NRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLP
AFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYS
GEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK
KGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELF
AKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV
LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM
REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKL
YNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEF
PVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICV
RFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:PRMT5/MEP50 complex
Synonyms:Androgen receptor cofactor p44 | MEP-50 | MEP50 | Methylosome protein 50 | Nbla10071 | WD repeat-containing protein 77 | WD45 | WDR77 | p44/Mep50
Type:Enzyme
Mol. Mass.:36713.38
Organism:Homo sapiens (Human)
Description:Q9BQA1
Residue:342
Sequence:
MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWL
FKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFC
KYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKD
SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLV
DTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFV
RDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM225230
n/a
NameBDBM225230
Synonyms:EED226
TypeSmall organic molecule
Emp. Form.C17H15N5O3S
Mol. Mass.369.398
SMILESCS(=O)(=O)c1ccc(cc1)-c1cnc(NCc2ccco2)n2cnnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: