Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetReceptor-type tyrosine-protein kinase FLT3 (FLT3)
LigandBDBM225230
Substrate/Competitorn/a
Meas. Tech.HMT Assay
IC50>1.0e+4± 0 nM
Citation Qi WZhao KGu JHuang YWang YZhang HZhang MZhang JYu ZLi LTeng LChuai SZhang CZhao MChan HChen ZFang DFei QFeng LFeng LGao YGe HGe XLi GLingel ALin YLiu YLuo FShi MWang LWang ZYu YZeng JZeng CZhang LZhang QZhou SOyang CAtadja PLi E An allosteric PRC2 inhibitor targeting the H3K27me3 binding pocket of EED. Nat Chem Biol 13:381-388 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Receptor-type tyrosine-protein kinase FLT3 (FLT3)
Name:Receptor-type tyrosine-protein kinase FLT3 (FLT3)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:49836.34
Organism:Homo sapiens (Human)
Description:Human FLT3 truncation (563-993 aa) with D835Y mutation
Residue:431
Sequence:
CHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYDLKWEFPRENLEFGKVLGSGAFG
KVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMSELKMMTQLGSHENIVNLLGACT
LSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSRE
VQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGMEFL
EFKSCVHRDLAARNVLVTHGKVVKICDFGLARYIMSDSNYVVRGNARLPVKWMAPESLFE
GIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIQNGFKMDQPFYATEEIYIIM
QSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLG
LLSPQAQVEDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM225230
n/a
NameBDBM225230
Synonyms:EED226
TypeSmall organic molecule
Emp. Form.C17H15N5O3S
Mol. Mass.369.398
SMILESCS(=O)(=O)c1ccc(cc1)-c1cnc(NCc2ccco2)n2cnnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: