Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPolycomb protein EED (EED)
LigandBDBM70577
Substrate/CompetitorH3(23-34)K27me3
Meas. Tech.EED A-395 Peptide Competition Assay
pH7.5±0
Temperature298.15±0 K
IC50 18.13± 0 nM
Citation He YSelvaraju SCurtin MLJakob CGZhu HComess KMShaw BThe JLima-Fernandes ESzewczyk MMCheng DKlinge KLLi HQPliushchev MAlgire MAMaag DGuo JDietrich JPanchal SCPetros AMSweis RFTorrent MBigelow LJSenisterra GLi FKennedy SWu QOsterling DJLindley DJGao WGalasinski SBarsyte-Lovejoy DVedadi MBuchanan FGArrowsmith CHChiang GGSun CPappano WN The EED protein-protein interaction inhibitor A-395 inactivates the PRC2 complex. Nat Chem Biol 13:389-395 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Polycomb protein EED (EED)
Name:EZH2/SUZ12/EED/RBBP7/RBBP4
Synonyms:EED | Polycomb protein EED | WAIT-1 | WD protein associating with integrin cytoplasmic tails 1 | hEED
Type:Protein
Mol. Mass.:50201.68
Organism:Homo sapiens (Human)
Description:O75530
Residue:441
Sequence:
MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTP
NAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNR
VTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITM
QCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVL
SADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFS
TRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQ
CDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR
DSSILIAVCDDASIWRWDRLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM70577
H3(23-34)K27me3
Name:H3(23-34)K27me3
Synonyms:n/a
Type:Protein
Mol. Mass.:1177.33
Organism:Homo sapiens (Human)
Description:Human biotinylated histone H3 (23-34 aa) trimethylated peptide
Residue:12
Sequence:
TKAARKSAPSTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: