| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-7 |
|---|
| Ligand | BDBM223992 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarization Assay |
|---|
| Temperature | 277.15±0 K |
|---|
| Kd | 8.6e+4± 3.1e+4 nM |
|---|
| Citation |  Dion, J; Deshayes, F; Storozhylova, N; Advedissian, T; Lambert, A; Viguier, M; Tellier, C; Dussouy, C; Poirier, F; Grandjean, C Lactosamine-Based Derivatives as Tools to Delineate the Biological Functions of Galectins: Application to Skin Tissue Repair. Chembiochem18:782-789 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galectin-7 |
|---|
| Name: | Galectin-7 |
|---|
| Synonyms: | Gal-7 | HKL-14 | LEG7_HUMAN | LGALS7 | PI7 | PIG1 | p53-induced gene 1 protein |
|---|
| Type: | Galactoside-binding protein |
|---|
| Mol. Mass.: | 15077.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 136 |
|---|
| Sequence: | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEV
VFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVR
LVEVGGDVQLDSVRIF
|
|
|
|---|
| BDBM223992 |
|---|
| n/a |
|---|
| Name | BDBM223992 |
|---|
| Synonyms: | 4-O-[3-O-(3-methoxybenzyl)-β-D-galactopyranosyl)]-1-azido-1,2-dideoxy-2-(3-methoxybenzamido)-β-D-glucopyranose (1) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H36N4O12 |
|---|
| Mol. Mass. | 620.605 |
|---|
| SMILES | COc1cccc(COC2[C@@H](O)C(CO)O[C@@H](O[C@@H]3C(CO)O[C@@H](N=[N+]=[N-])C(NC(=O)c4cccc(OC)c4)C3O)C2O)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
