| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mas-related G-protein coupled receptor member X2 |
|---|
| Ligand | BDBM224033 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Intracellular Calcium Mobilization Assay |
|---|
| pH | 7.4±0 |
|---|
| Temperature | 303.15±0 K |
|---|
| EC50 | 1.5e+4±7.6e+3 nM |
|---|
| Citation |  Lansu, K; Karpiak, J; Liu, J; Huang, XP; McCorvy, JD; Kroeze, WK; Che, T; Nagase, H; Carroll, FI; Jin, J; Shoichet, BK; Roth, BL In silico design of novel probes for the atypical opioid receptor MRGPRX2. Nat Chem Biol13:529-536 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mas-related G-protein coupled receptor member X2 |
|---|
| Name: | Mas-related G-protein coupled receptor member X2 |
|---|
| Synonyms: | MRGPRX2 | MRGX2 | MRGX2_HUMAN | Mas-related G protein-coupled receptor X2 (MRGPRX2) | Mas-related G-protein coupled receptor member X2 |
|---|
| Type: | GPCR |
|---|
| Mol. Mass.: | 37104.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q96LB1 |
|---|
| Residue: | 330 |
|---|
| Sequence: | MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMR
RNAFSVYVLSLAGADFLFLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSML
STVSTERCLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDSGWC
QTFDFITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFG
IQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLAL
QRALQDIAEVDHSEGCFRQGTPEMSRSSLV
|
|
|
|---|
| BDBM224033 |
|---|
| n/a |
|---|
| Name | BDBM224033 |
|---|
| Synonyms: | Dynorphin A (1-9) | YGGFLRRXR |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C53H86N18O11 |
|---|
| Mol. Mass. | 1151.3639 |
|---|
| SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
