| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 5 [180-384] |
|---|
| Ligand | BDBM50336799 |
|---|
| Substrate/Competitor | p-Nitrophenol (p-NPP) |
|---|
| Meas. Tech. | p-NPP Assay |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | 25±5 nM |
|---|
| IC50 | 4.4e+4± 6e+3 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Neumann, TS; Span, EA; Kalous, KS; Bongard, R; Gastonguay, A; Lepley, MA; Kutty, RG; Nayak, J; Bohl, C; Lange, RG; Sarker, MI; Talipov, MR; Rathore, R; Ramchandran, R; Sem, DS Identification of inhibitors that target dual-specificity phosphatase 5 provide new insights into the binding requirements for the two phosphate pockets. BMC Biochem16:19 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 5 [180-384] |
|---|
| Name: | Dual specificity protein phosphatase 5 [180-384] |
|---|
| Synonyms: | DUS5_HUMAN | DUSP5 | Dual-specificity phosphatase 5 phophatase domain (DUSP5 PD) | VH3 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 22525.06 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human DUSP5 C-terminal phosphatase domain (180-384 aa) |
|---|
| Residue: | 205 |
|---|
| Sequence: | VEILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADIS
SHFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTKQFRLKEAFDYIKQRRSM
VSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPAS
VLAPVPTHSTVSELSRSPVATATSC
|
|
|
|---|
| BDBM50336799 |
|---|
| p-Nitrophenol (p-NPP) |
|---|
| Name | BDBM50336799 |
|---|
| Synonyms: | 5,5',5''-[1,3,6-naphthalenetriyltris(sulfonylimino)]tris[1,3-benzenesulfonate analogue | 8,8'-(Carbonylbis(imino-3,1-phenylenecarbonylimino(4-methyl-3,1-phenylene)carbonylimino))bisnaphthalene-1,3,5-trisulphonic acid | 8,8'-[CARBONYLBIS[IMINO-3,1-PHENYLENECARBONYLIMINO(4-METHYL-3,1-PHENYLENE)CARBONYLIMINO]]BIS-1,3,5-NAPHTHALENETRISULFONIC ACID | 8,8'-[Carbonylbis[imino-3,1-phenylenecarbonylimino(4-methyl-3,1-phenylene)carbonyl-imino]]bis-1,3,5-naphthalenetrisulfonic acid(suramin) | 8-[(4-methyl-3-{[3-({[3-({2-methyl-5-[(4,6,8-trisulfonaphthalen-1-yl)carbamoyl]phenyl}carbamoyl)phenyl]carbamoyl}amino)benzene]amido}benzene)amido]naphthalene-1,3,5-trisulfonic acid | CHEMBL265502 | Germanin | Suramin hexasodium | US8835659, Suramin | Urea derivative | suramin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C51H40N6O23S6 |
|---|
| Mol. Mass. | 1297.28 |
|---|
| SMILES | Cc1ccc(cc1NC(=O)c1cccc(NC(=O)Nc2cccc(c2)C(=O)Nc2cc(ccc2C)C(=O)Nc2ccc(c3cc(cc(c23)S(O)(=O)=O)S(O)(=O)=O)S(O)(=O)=O)c1)C(=O)Nc1ccc(c2cc(cc(c12)S(O)(=O)=O)S(O)(=O)=O)S(O)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
