Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCHK1_Kinase
LigandBDBM91914
Substrate/Competitorn/a
Meas. Tech.33P-Radiometric_Method1
Ki 4.57±n/a nM
Citation D3R DD Abbott CHK1 Kinase D3R  221 Publication Date 6/30/2015
More Info.:Get all data from this article,  Assay Method
 
CHK1_Kinase
Name:CHK1_Kinase
Synonyms:n/a
Type:n/a
Mol. Mass.:32109.16
Organism:Homo sapiens (Human)
Description:n/a
Residue:279
Sequence:
AVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKM
LNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYL
HGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKR
REFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLAL
LHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM91914
n/a
NameBDBM91914
Synonyms:Chk1_48
Typen/a
Emp. Form.C17H16ClN5O4
Mol. Mass.389.793
SMILESOC1CC(CC1O)Oc1ccc(Cl)cc1NC(=O)Nc1cnc(cn1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: