Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCHK1_Kinase
LigandBDBM50221589
Substrate/Competitorn/a
Meas. Tech.33P-Radiometric_Method1
Ki 5.22±n/a nM
Citation D3R DD Abbott CHK1 Kinase D3R  221 Publication Date 6/30/2015
More Info.:Get all data from this article,  Assay Method
 
CHK1_Kinase
Name:CHK1_Kinase
Synonyms:n/a
Type:n/a
Mol. Mass.:32109.16
Organism:Homo sapiens (Human)
Description:n/a
Residue:279
Sequence:
AVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKM
LNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYL
HGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKR
REFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLAL
LHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50221589
n/a
NameBDBM50221589
Synonyms:4-((6,7-dimethoxy-1,4-dihydroindeno[1,2-c]pyrazol-3-yl)ethynyl)-2-methoxyphenol | 4-(6,7-dimethoxy-2,4-dihydro-indeno[1,2-c]pyrazol-3-ylethynyl)-2-methoxy-phenol | CHEMBL248396 | Chk1_146
TypeSmall organic molecule
Emp. Form.C21H18N2O4
Mol. Mass.362.3786
SMILESCOc1cc2Cc3c(n[nH]c3C#Cc3ccc(O)c(OC)c3)-c2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: