Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSYK Kinase
LigandBDBM26179
Substrate/Competitorn/a
Meas. Tech.SYK assay_HTRF
IC50 533±n/a nM
Citation D3R DD GSK SYK Kinase D3R  225 Publication Date 6/30/2015
More Info.:Get all data from this article,  Assay Method
 
SYK Kinase
Name:SYK Kinase
Synonyms:n/a
Type:n/a
Mol. Mass.:32610.83
Organism:Homo sapiens (Human)
Description:n/a
Residue:281
Sequence:
PEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALK
DELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIEL
VHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKW
PVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCP
AGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26179
n/a
NameBDBM26179
Synonyms:2,4-dianilino pyrimidine, 36 | 3-{[4-(1H-indazol-4-ylamino)pyrimidin-2-yl]amino}benzamide | GTC000110A
TypeSmall organic molecule
Emp. Form.C18H15N7O
Mol. Mass.345.358
SMILESNC(=O)c1cccc(Nc2nccc(Nc3cccc4[nH]ncc34)n2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: