| Reaction Details |
|---|
 | Report a problem with these data |
| Target | High affinity nerve growth factor receptor [441-796] |
|---|
| Ligand | BDBM226856 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Cell Based Assay |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 4.66±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Bagal, SK; Cui, JJ; Greasley, SE; Lunney, EA; McAlpine, IJ; Nagata, A; Ninkovic, S; Omoto, K; Skerratt, SE; Storer, RI; Warmus, JS Tropomyosin-related kinase inhibitors US Patent US9328096 Publication Date 5/3/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| High affinity nerve growth factor receptor [441-796] |
|---|
| Name: | High affinity nerve growth factor receptor [441-796] |
|---|
| Synonyms: | MTC | NTRK1 | NTRK1_HUMAN | TRK | TRKA | Tyrosine kinase receptor A | Tyrosine kinase receptor A (TrkA) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 39939.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human his-tagged TrkA cytoplasmic domain (441-796 aa) |
|---|
| Residue: | 356 |
|---|
| Sequence: | KCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDA
CVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQRE
AELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPG
PLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDY
YRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCI
TQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
|
|
|
|---|
| BDBM226856 |
|---|
| n/a |
|---|
| Name | BDBM226856 |
|---|
| Synonyms: | US9328096, 549 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H22Cl2FN5O3 |
|---|
| Mol. Mass. | 554.4 |
|---|
| SMILES | Fc1cccnc1-c1cc(C(=O)Nc2cc(nn2-c2ccccc2)C(=O)NCC2CCOC2)c(Cl)cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
