| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Ligand | BDBM227632 |
|---|
| Substrate/Competitor | BDBM227640 |
|---|
| Meas. Tech. | In Vitro MTH1 Enzymatic Assay |
|---|
| pH | 7.5±n/a |
|---|
| IC50 | 1.13e+3± 5.0e+2 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Kumar, A; Kawamura, T; Kawatani, M; Osada, H; Zhang, KYJ Identification and structure-activity relationship of purine derivatives as novel MTH1 inhibitors. Chem Biol Drug Des89:862-869 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Name: | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Synonyms: | 7,8-dihydro-8-oxoguanine triphosphatase | 8ODP_HUMAN | MTH1 | MutT homolog 1 protein (MTH1) | NUDT1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 22514.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P36639 |
|---|
| Residue: | 197 |
|---|
| Sequence: | MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVL
LGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPE
LMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKF
QGQDTILDYTLREVDTV
|
|
|
|---|
| BDBM227632 |
|---|
| BDBM227640 |
|---|
| Name | BDBM227632 |
|---|
| Synonyms: | MTH1 inhibitor, 53 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H12N6 |
|---|
| Mol. Mass. | 240.2639 |
|---|
| SMILES | Nc1nc(NCc2ccccc2)c2nc[nH]c2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
