Reaction Details |
| Report a problem with these data |
Target | Bromodomain-containing protein 4 [44-166,D144A] |
---|
Ligand | BDBM50365262 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Thermal Shift Assay (TSA) |
---|
pH | 7.5±n/a |
---|
Kd | 1.0±0.0 nM |
---|
Comments | extracted |
---|
Citation | Jung, M; Philpott, M; Müller, S; Schulze, J; Badock, V; Eberspächer, U; Moosmayer, D; Bader, B; Schmees, N; Fernández-Montalván, A; Haendler, B Affinity map of bromodomain protein 4 (BRD4) interactions with the histone H4 tail and the small molecule inhibitor JQ1. J Biol Chem289:9304-19 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bromodomain-containing protein 4 [44-166,D144A] |
---|
Name: | Bromodomain-containing protein 4 [44-166,D144A] |
Synonyms: | BRD4 | BRD4_HUMAN | Bromodomain protein 4 bromodomain 1 (BRD4 BD1 D144A) | HUNK1 |
Type: | Protein |
Mol. Mass.: | 14567.28 |
Organism: | Homo sapiens (Human) |
Description: | Human BRD4 BD1 (44-166 aa) D144A mutant |
Residue: | 123 |
Sequence: | NPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKT
PMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGADIVLMAEALEKLFLQKINE
LPT
|
|
|
BDBM50365262 |
---|
n/a |
---|
Name | BDBM50365262 |
Synonyms: | (+)-JQ1 | (S)-JQ1 (1) | CHEMBL1957266 | JQ1 | US10124009, Compound (S)-JQ1 | US10202360, Example JQ-1 | US10308662, Compound JQ-1 | US10407441, Compound (S)-JQ1 | US10617680, Example JQ-1 | US10881668, Compound JQ1 | US10925881, Name (S)-JQ1 | US11020380, Example JQ-1 | US11078188, Example (+)-JQ1 | US11279703, TABLE 6.180 | US11427593, Compound JQ1 | US11466034, Example (+)-JQ1 | US9320741, (S)-JQ1 | US9695172, JQ1 |
Type | Small organic molecule |
Emp. Form. | C23H25ClN4O2S |
Mol. Mass. | 456.988 |
SMILES | Cc1nnc2[C@H](CC(=O)OC(C)(C)C)N=C(c3c(C)c(C)sc3-n12)c1ccc(Cl)cc1 |r,c:14| |
Structure |
|