Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetbeta-Glucuronidase (β-glucuronidase)
LigandBDBM163643
Substrate/Competitorn/a
Meas. Tech.Cell-Based Assay
EC50 793.1±27.9 nM
Citation Redinbo MR Selective β-glucuronidase inhibitors as a treatment for side effects of camptothecin antineoplastic agents US Patent  US9334288 Publication Date 5/10/2016
More Info.:Get all data from this article,  Assay Method
 
beta-Glucuronidase (β-glucuronidase)
Name:beta-Glucuronidase (β-glucuronidase)
Synonyms:β-Glucuronidase | Beta-G1 | Beta-glucuronidase | GUSB
Type:Protein
Mol. Mass.:74736.05
Organism:Homo sapiens (Human)
Description:n/a
Residue:651
Sequence:
MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFE
EQWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVWYEREVILPERWTQDLRTRVV
LRIGSAHSYAIVWVNGVDTLEHEGGYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTT
LPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTSVEQD
SGLVNYQISVKGSNLFKLEVRLLDAENKVVANGTGTQGQLKVPGVSLWWPYLMHERPAYL
YSLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNKHEDADIRGKG
FDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNN
VSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMVIAHTKSLDPSRPVT
FVSNSNYAADKGAPYVDVICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSE
YGAETIAGFHQDPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTR
VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSLFT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM163643
n/a
NameBDBM163643
Synonyms:2[4(2H1,3benzodioxol5ylmethyl)piperazin1yl]N(2,5dimethoxycyclohexyl)acetamide (Inh 8) | US9334288, 8
TypeSmall organic molecule
Emp. Form.C22H33N3O5
Mol. Mass.419.5145
SMILESCOC1CCC(OC)C(C1)NC(=O)CN1CCN(Cc2ccc3OCOc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: