| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Membrane-associated progesterone receptor component 1 |
|---|
| Ligand | BDBM86689 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.64±n/a nM |
|---|
| Citation |  Jacobson, PB; von Geldern, TW; Ohman, L; Osterland, M; Wang, J; Zinker, B; Wilcox, D; Nguyen, PT; Mika, A; Fung, S; Fey, T; Goos-Nilsson, A; Grynfarb, M; Barkhem, T; Marsh, K; Beno, DW; Nga-Nguyen, B; Kym, PR; Link, JT; Tu, N; Edgerton, DS; Cherrington, A; Efendic, S; Lane, BC; Opgenorth, TJ Hepatic glucocorticoid receptor antagonism is sufficient to reduce elevated hepatic glucose output and improve glucose control in animal models of type 2 diabetes. J Pharmacol Exp Ther314:191-200 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Membrane-associated progesterone receptor component 1 |
|---|
| Name: | Membrane-associated progesterone receptor component 1 |
|---|
| Synonyms: | 25dx | Lewi | Membrane-associated progesterone receptor component 1 | PGRC1_RAT | Pgrmc | Pgrmc1 | progesterone |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 21581.66 |
|---|
| Organism: | RAT |
|---|
| Description: | progesterone 0 RAT::P70580 |
|---|
| Residue: | 195 |
|---|
| Sequence: | MAAEDVVATGADPSELEGGGLLQEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDD
EPPPLPRLKPRDFTPAELRRYDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRD
ASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGKLLKEGEEPTVY
SDDEEPKDEAARKSD
|
|
|
|---|
| BDBM86689 |
|---|
| n/a |
|---|
| Name | BDBM86689 |
|---|
| Synonyms: | CAS_84371-65-3 | NSC_55245 | RU-486 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H35NO2 |
|---|
| Mol. Mass. | 429.5937 |
|---|
| SMILES | CC#CC1(O)CCC2C3CCC4=CC(=O)CCC4=C3C(CC12C)c1ccc(cc1)N(C)C |c:18,t:11| |
|---|
| Structure | 
|
|---|
Search and Browse
