Reaction Details |
| Report a problem with these data |
Target | Membrane-associated progesterone receptor component 1 |
---|
Ligand | BDBM86689 |
---|
Substrate/Competitor | n/a |
---|
Ki | 0.64±n/a nM |
---|
Citation | Jacobson, PB; von Geldern, TW; Ohman, L; Osterland, M; Wang, J; Zinker, B; Wilcox, D; Nguyen, PT; Mika, A; Fung, S; Fey, T; Goos-Nilsson, A; Grynfarb, M; Barkhem, T; Marsh, K; Beno, DW; Nga-Nguyen, B; Kym, PR; Link, JT; Tu, N; Edgerton, DS; Cherrington, A; Efendic, S; Lane, BC; Opgenorth, TJ Hepatic glucocorticoid receptor antagonism is sufficient to reduce elevated hepatic glucose output and improve glucose control in animal models of type 2 diabetes. J Pharmacol Exp Ther314:191-200 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Membrane-associated progesterone receptor component 1 |
---|
Name: | Membrane-associated progesterone receptor component 1 |
Synonyms: | 25dx | Lewi | Membrane-associated progesterone receptor component 1 | PGRC1_RAT | Pgrmc | Pgrmc1 | progesterone |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 21581.66 |
Organism: | RAT |
Description: | progesterone 0 RAT::P70580 |
Residue: | 195 |
Sequence: | MAAEDVVATGADPSELEGGGLLQEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDD
EPPPLPRLKPRDFTPAELRRYDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRD
ASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGKLLKEGEEPTVY
SDDEEPKDEAARKSD
|
|
|
BDBM86689 |
---|
n/a |
---|
Name | BDBM86689 |
Synonyms: | CAS_84371-65-3 | NSC_55245 | RU-486 |
Type | Small organic molecule |
Emp. Form. | C29H35NO2 |
Mol. Mass. | 429.5937 |
SMILES | CC#CC1(O)CCC2C3CCC4=CC(=O)CCC4=C3C(CC12C)c1ccc(cc1)N(C)C |c:18,t:11| |
Structure |
|