| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
|---|
| Ligand | BDBM228660 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | IDH1 Biochemical Assay |
|---|
| IC50 | 29000±1.3 nM |
|---|
| Citation |  Davis, MI; Gross, S; Shen, M; Straley, KS; Pragani, R; Lea, WA; Popovici-Muller, J; DeLaBarre, B; Artin, E; Thorne, N; Auld, DS; Li, Z; Dang, L; Boxer, MB; Simeonov, A Biochemical, cellular, and biophysical characterization of a potent inhibitor of mutant isocitrate dehydrogenase IDH1. J Biol Chem289:13717-25 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
|---|
| Name: | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
|---|
| Synonyms: | Cytosolic NADP-isocitrate dehydrogenase (IDH1)(R132H) | IDH1 | IDH1 R132H | IDH1(R132H) | IDHC_HUMAN | Isocitrate dehydrogenase (IDH1)(R132H) | Isocitrate dehydrogenase 1 mutant (R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (R132H) | PICD |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 46641.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human IDH1 R132H (SEQ ID No. 2 in patent). First three are removed. Google patent parsed wrong. |
|---|
| Residue: | 414 |
|---|
| Sequence: | MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
|
|
|
|---|
| BDBM228660 |
|---|
| n/a |
|---|
| Name | BDBM228660 |
|---|
| Synonyms: | (-)-2-(2-(1H-Benzo[d]imidazol-1-yl)-N-(3-fluorophenyl)acetamido)-N-cyclopentyl-2-o-tolylacetamide | (-)-ML309 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H29FN4O2 |
|---|
| Mol. Mass. | 484.5646 |
|---|
| SMILES | Cc1ccccc1[C@H](N(C(=O)Cn1cnc2ccccc12)c1cccc(F)c1)C(=O)NC1CCCC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
