| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein 5 [K24A,R33A,K34A] |
|---|
| Ligand | BDBM50152850 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Ligand Binding Assay |
|---|
| pH | 8.2±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| Ki | 3.06e+3±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Armstrong, EH; Goswami, D; Griffin, PR; Noy, N; Ortlund, EA Structural basis for ligand regulation of the fatty acid-binding protein 5, peroxisome proliferator-activated receptor ß/d (FABP5-PPARß/d) signaling pathway. J Biol Chem289:14941-54 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein 5 [K24A,R33A,K34A] |
|---|
| Name: | Fatty acid-binding protein 5 [K24A,R33A,K34A] |
|---|
| Synonyms: | FABP5 | FABP5_HUMAN | Fatty acid-binding protein 5 (FABP5)(NLSm) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14962.47 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human FABP5 NLS-deficient mutant (K24A/K34A/R33A) |
|---|
| Residue: | 135 |
|---|
| Sequence: | MATVQQLEGRWRLVDSKGFDEYMAELGVGIALAAMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
|
|
|
|---|
| BDBM50152850 |
|---|
| n/a |
|---|
| Name | BDBM50152850 |
|---|
| Synonyms: | 1-HEXYLDECANOIC ACID | CHEMBL82293 | Hexadecanoic acid | Hexadecanoic acid anion | Palmitic acid (PA) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H32O2 |
|---|
| Mol. Mass. | 256.4241 |
|---|
| SMILES | CCCCCCCCCCCCCCCC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
