Reaction Details |
| Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Ligand | BDBM231620 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Kinetics Assay |
---|
pH | 7.5±n/a |
---|
Ki | 81.9±1.9 nM |
---|
Comments | extracted |
---|
Citation | Schiebel, J; Chang, A; Shah, S; Lu, Y; Liu, L; Pan, P; Hirschbeck, MW; Tareilus, M; Eltschkner, S; Yu, W; Cummings, JE; Knudson, SE; Bommineni, GR; Walker, SG; Slayden, RA; Sotriffer, CA; Tonge, PJ; Kisker, C Rational design of broad spectrum antibacterial activity based on a clinically relevant enoyl-acyl carrier protein (ACP) reductase inhibitor. J Biol Chem289:15987-6005 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
Synonyms: | Enoyl - (acyl carrier protein) reductase | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-acyl carrier protein reductase (FabI) | FABI_ECOLI | NADH-dependent enoyl-ACP reductase | envM | fabI |
Type: | Enzyme |
Mol. Mass.: | 27861.12 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 262 |
Sequence: | MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
|
|
|
BDBM231620 |
---|
n/a |
---|
Name | BDBM231620 |
Synonyms: | CG400549 | US10071965, Compound CG400549 |
Type | Small organic molecule |
Emp. Form. | C19H20N2O2S |
Mol. Mass. | 340.439 |
SMILES | Cc1c(N)cccc1Cn1ccc(OCCc2cccs2)cc1=O |
Structure |
|