| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Ligand | BDBM190661 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Kinetics Assay |
|---|
| pH | 7.5±n/a |
|---|
| Ki | 7.0±0.1 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Schiebel, J; Chang, A; Shah, S; Lu, Y; Liu, L; Pan, P; Hirschbeck, MW; Tareilus, M; Eltschkner, S; Yu, W; Cummings, JE; Knudson, SE; Bommineni, GR; Walker, SG; Slayden, RA; Sotriffer, CA; Tonge, PJ; Kisker, C Rational design of broad spectrum antibacterial activity based on a clinically relevant enoyl-acyl carrier protein (ACP) reductase inhibitor. J Biol Chem289:15987-6005 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
|---|
| Synonyms: | Enoyl - (acyl carrier protein) reductase | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-acyl carrier protein reductase (FabI) | FABI_ECOLI | NADH-dependent enoyl-ACP reductase | envM | fabI |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27861.12 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 262 |
|---|
| Sequence: | MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
|
|
|
|---|
| BDBM190661 |
|---|
| n/a |
|---|
| Name | BDBM190661 |
|---|
| Synonyms: | PT166 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H25NO2 |
|---|
| Mol. Mass. | 299.4073 |
|---|
| SMILES | CCCCCCc1cc(=O)c(Oc2ccccc2C)cn1C |
|---|
| Structure | 
|
|---|
Search and Browse
