Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosinase
LigandBDBM233016
Substrate/Competitorn/a
Meas. Tech.MT Kinetic Assay
pH6.8±0
Temperature310.15±0 K
Ki 1.05e+3± 1.4e+2 nM
Citation Amin ESaboury AAMansuri-Torshizi HMoosavi-Movahedi AA Potent inhibitory effects of benzyl and p-xylidine-bis dithiocarbamate sodium salts on activities of mushroom tyrosinase. J Enzyme Inhib Med Chem 25:272-81 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosinase
Name:Tyrosinase
Synonyms:Polyphenol oxidase
Type:Enzyme
Mol. Mass.:63902.83
Organism:Agaricus bisporus (White button mushroom)
Description:Q00024
Residue:568
Sequence:
MSHLLVSPLGGGVQPRLEINNFVKNDRQFSLYVQALDRMYATPQNETASYFQVAGVHGYP
LIPFDDAVGPTEFSPFDQWTGYCTHGSTLFPTWHRPYVLILEQILSGHAQQIADTYTVNK
SEWKKAATEFRHPYWDWASNSVPPPEVISLPKVTITTPNGQKTSVANPLMRYTFNSVNDG
GFYGPYNQWDTTLRQPDSTGVNAKDNVNRLKSVLKNAQASLTRATYDMFNRVTTWPHFSS
HTPASGGSTSNSIEAIHDNIHVLVGGNGHMSDPSVAPFDPIFFLHHANVDRLIALWSAIR
YDVWTSPGDAQFGTYTLRYKQSVDESTDLAPWWKTQNEYWKSNELRSTESLGYTYPEFVG
LDMYNKDAVNKTISRKVAQLYGPQRGGQRSLVEDLSNSHARRSQRPAKRSRLGQLLKGLF
SDWSAQIKFNRHEVGQSFSVCLFLGNVPEDPREWLVSPNLVGARHAFVRSVKTDHVAEEI
GFIPINQWIAEHTGLPSFAVDLVKPLLAQGLQWRVLLADGTPAELDSLEVTILEVPSELT
DDEPNPRSRPPRYHKDITHGKRGGCREA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM233016
n/a
NameBDBM233016
Synonyms:p-Xylidine-bis(dithiocarbamate) sodium salt (II)
TypeSmall organic molecule
Emp. Form.C10H10N2S4
Mol. Mass.286.461
SMILES[S-]C(=S)NCc1ccc(CNC([S-])=S)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: